Class a: All alpha proteins [46456] (289 folds) |
Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.103.1: Citrate synthase [48256] (2 families) |
Family a.103.1.0: automated matches [191476] (1 protein) not a true family |
Protein automated matches [190763] (12 species) not a true protein |
Species Neosartorya fumigata [TaxId:746128] [347633] (5 PDB entries) |
Domain d5uqua1: 5uqu A:29-465 [347731] Other proteins in same PDB: d5uqua2 automated match to d3enja_ complexed with coa, oaa, so4; mutant |
PDB Entry: 5uqu (more details), 1.7 Å
SCOPe Domain Sequences for d5uqua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uqua1 a.103.1.0 (A:29-465) automated matches {Neosartorya fumigata [TaxId: 746128]} staepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldp eegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshl pqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsislla kiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgd heggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkigtkft dddvrnylwdtlksgrvvpgyghavlrkpdprfqalmdfaatrpdvlanpvfqlvkknse iapavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliwdral glpierpksinllglkk
Timeline for d5uqua1: