SCOPe 2.07: Domain d5ubvb1: 5ubv B:3-245

Lineage for d5ubvb1 (5ubv B:3-245)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Myceliophthora thermophila [TaxId:573729] [347652] (1 PDB entry)

8. Domain d5ubvb1: 5ubv B:3-245 [347720]
   Other proteins in same PDB: d5ubva2, d5ubvb2
   automated match to d3h4ma_
   complexed with adp, cit, gol

Details for d5ubvb1

PDB Entry: 5ubv, 2.45 Å

PDB Description: atpase domain of i-aaa protease from myceliophthora thermophila

PDB Compounds: (B:) ATPase domain of i-AAA protease

SCOPe Domain Sequences for d5ubvb1:

Sequence, based on SEQRES records:

>d5ubvb1 c.37.1.0 (B:3-245) automated matches {Myceliophthora thermophila [TaxId: 573729]}
arfsdvhgcdeakeelqelveflrnpekfsnlggklpkgvllvgppgtgktllaravage
agvpffymsgsefdeiyvgvgakrvrelfnaakakapsivfideldaiggrrnsrdatyv
rqtlnqlltemdgfaqnsgviilgatnfpesldkaltrpgrfdrhvhvslpdvrgriail
khhakkikigsdvniaaiaartsglsgaelenivnqaavhaskekakavmqahfewakdk
vim

Sequence, based on observed residues (ATOM records):

>d5ubvb1 c.37.1.0 (B:3-245) automated matches {Myceliophthora thermophila [TaxId: 573729]}
arfsdvhgcdeakeelqelveflrnpekfsnlggklpkgvllvgppgtgktllaravage
agvpffymsgsefdeiyvgvgakrvrelfnaakakapsivfideldaiggrryvrqtlnq
lltemdgfaqnsgviilgatnfpesldkaltrpgrfdrhvhvslpdvrgriailkhhakk
ikigsdvniaaiaartsglsgaelenivnqaavhaskekakavmqahfewakdkvim

Timeline for d5ubvb1:

• d5ubvb1 is new in SCOPe 2.07-stable
  
• d5ubvb1 appears in the current release, SCOPe 2.08