Lineage for d5un2a2 (5un2 A:2039-2143)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2373405Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 2373509Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. 2373510Protein automated matches [190458] (4 species)
    not a true protein
  7. 2373581Species Mouse (Mus musculus) [TaxId:10090] [187373] (15 PDB entries)
  8. 2373628Domain d5un2a2: 5un2 A:2039-2143 [347716]
    automated match to d5i8da2
    complexed with ca, k; mutant

Details for d5un2a2

PDB Entry: 5un2 (more details), 2.96 Å

PDB Description: crystal structure of mouse cadherin-23 ec19-21 with non-syndromic deafness (dfnb12) associated mutation r2029w
PDB Compounds: (A:) cadherin-23

SCOPe Domain Sequences for d5un2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5un2a2 b.1.6.0 (A:2039-2143) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dndnwptfspptytvhllencppgfsvlqvtatdedsglngelvyrieagaqdrflihpv
tgvirvgnatidreeqesyrltvvatdrgtvplsgtaivtilidd

SCOPe Domain Coordinates for d5un2a2:

Click to download the PDB-style file with coordinates for d5un2a2.
(The format of our PDB-style files is described here.)

Timeline for d5un2a2: