SCOPe 2.07: Domain d5ufzb_: 5ufz B:

Lineage for d5ufzb_ (5ufz B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (578 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d5ufzb_: 5ufz B: [347643]
   automated match to d2i4ua_
   complexed with 8bg

Details for d5ufzb_

PDB Entry: 5ufz, 1.65 Å

PDB Description: hiv-1 protease complexed with inhibitor: (3r,3as,6ar)-hexahydrofuro[2, 3-b]furan-3-yl [(1s,2s)-1-(1-{[(4-aminophenyl)sulfonyl](2- methylpropyl)amino}cyclopropyl)-1-hydroxy-3-phenylpropan-2- yl]carbamate

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d5ufzb_:

Sequence; same for both SEQRES and ATOM records:

>d5ufzb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigmtlnf

Timeline for d5ufzb_:

• d5ufzb_ is new in SCOPe 2.07-stable
  
• d5ufzb_ appears in the current release, SCOPe 2.08