Lineage for d5qaua_ (5qau A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2619748Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2619749Protein automated matches [190857] (70 species)
    not a true protein
  7. 2620117Species Klebsiella pneumoniae [TaxId:573] [225260] (109 PDB entries)
  8. 2620180Domain d5qaua_: 5qau A: [347507]
    automated match to d4s2kb_
    complexed with cl, edo, v7v

Details for d5qaua_

PDB Entry: 5qau (more details), 1.75 Å

PDB Description: oxa-48 in complex with compound 26a
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5qaua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qaua_ e.3.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
ewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdl
gvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafd
ygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdy
iiraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqeki
ip

SCOPe Domain Coordinates for d5qaua_:

Click to download the PDB-style file with coordinates for d5qaua_.
(The format of our PDB-style files is described here.)

Timeline for d5qaua_: