Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [225260] (109 PDB entries) |
Domain d5qaad_: 5qaa D: [347405] automated match to d4s2kb_ complexed with cl, eaj, edo |
PDB Entry: 5qaa (more details), 1.95 Å
SCOPe Domain Sequences for d5qaad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5qaad_ e.3.1.0 (D:) automated matches {Klebsiella pneumoniae [TaxId: 573]} ewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdl gvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafd ygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdy iiraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqeki ip
Timeline for d5qaad_: