Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) |
Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species) |
Species Streptococcus sp., group G [TaxId:1306] [54361] (40 PDB entries) |
Domain d5ofsc_: 5ofs C: [347168] automated match to d2onqa_ complexed with act, cl, edo, mpd, mrd, so4, zn; mutant |
PDB Entry: 5ofs (more details), 1.1 Å
SCOPe Domain Sequences for d5ofsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ofsc_ d.15.7.1 (C:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]} mqfklilngktlkgvitieavdhaeaekffkqyandngvdgewtydeathtftvte
Timeline for d5ofsc_: