SCOPe 2.07: Domain d5nfrh2: 5nfr H:144-313

Lineage for d5nfrh2 (5nfr H:144-313)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (47 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [346822] (1 PDB entry)

8. Domain d5nfrh2: 5nfr H:144-313 [347164]
   Other proteins in same PDB: d5nfra1, d5nfrb1, d5nfrc1, d5nfrd1, d5nfre1, d5nfrf1, d5nfrg1, d5nfrh1, d5nfri1, d5nfrj1, d5nfrk1, d5nfrl1, d5nfrm1, d5nfrn1, d5nfro1, d5nfrp1
   automated match to d3p7ma2
   complexed with cit

Details for d5nfrh2

PDB Entry: 5nfr, 2.4 Å

PDB Description: crystal structure of malate dehydrogenase from plasmodium falciparum (pfmdh)

PDB Compounds: (H:) malate dehydrogenase

SCOPe Domain Sequences for d5nfrh2:

Sequence; same for both SEQRES and ATOM records:

>d5nfrh2 d.162.1.0 (H:144-313) automated matches {Plasmodium falciparum [TaxId: 36329]}
gildtsrycsliadklkvsaedvnavilgghgdlmvplqrytsvngvplsefvkknmisq
neiqeiiqktrnmgaeiiklakasaafapaaaitkmiksylynennlftcavylnghync
snlfvgstakinnkgahpvefpltkeeqdlytesiasvqsntqkafdlik

Timeline for d5nfrh2:

• d5nfrh2 is new in SCOPe 2.07-stable
  
• d5nfrh2 appears in the current release, SCOPe 2.08