Lineage for d1a88b_ (1a88 B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26794Family c.69.1.12: Haloperoxidase [53531] (5 proteins)
  6. 26806Protein Chloroperoxidase L [53538] (1 species)
  7. 26807Species Streptomyces lividans [TaxId:1916] [53539] (1 PDB entry)
  8. 26809Domain d1a88b_: 1a88 B: [34708]

Details for d1a88b_

PDB Entry: 1a88 (more details), 1.9 Å

PDB Description: chloroperoxidase l

SCOP Domain Sequences for d1a88b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a88b_ c.69.1.12 (B:) Chloroperoxidase L {Streptomyces lividans}
gtvttsdgtnifykdwgprdglpvvfhhgwplsaddwdnqmlfflshgyrviahdrrghg
rsdqpstghdmdtyaadvaaltealdlrgavhighstgggevaryvaraepgrvakavlv
savppvmvksdtnpdglplevfdefraalaanraqfyidvpsgpfygfnregatvsqgli
dhwwlqgmmgaanahyeciaafsetdftddlkridvpvlvahgtddqvvpyadaapksae
llanatlksyeglphgmlsthpevlnpdllafvks

SCOP Domain Coordinates for d1a88b_:

Click to download the PDB-style file with coordinates for d1a88b_.
(The format of our PDB-style files is described here.)

Timeline for d1a88b_: