Lineage for d1a88a_ (1a88 A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) 
Family c.69.1.12: Haloperoxidase [53531] (5 proteins) 
Protein Chloroperoxidase L [53538] (1 species) Species Streptomyces lividans [TaxId:1916] [53539] (1 PDB entry) 
Domain d1a88a_: 1a88 A: [34707]
Details for d1a88a_
PDB Entry: 1a88 (more details), 1.9 Å
PDB Description: chloroperoxidase l
SCOP Domain Sequences for d1a88a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans}
gtvttsdgtnifykdwgprdglpvvfhhgwplsaddwdnqmlfflshgyrviahdrrghg
rsdqpstghdmdtyaadvaaltealdlrgavhighstgggevaryvaraepgrvakavlv
savppvmvksdtnpdglplevfdefraalaanraqfyidvpsgpfygfnregatvsqgli
dhwwlqgmmgaanahyeciaafsetdftddlkridvpvlvahgtddqvvpyadaapksae
llanatlksyeglphgmlsthpevlnpdllafvks
SCOP Domain Coordinates for d1a88a_:
Click to download the PDB-style file with coordinates for d1a88a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a88a_:
- d1a88a_ appears in SCOP 1.57
- d1a88a_ appears in the current release, SCOPe 2.08
View in 3D
