SCOPe 2.07: Domain d5o2ac1: 5o2a C:2-122

Lineage for d5o2ac1 (5o2a C:2-122)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.2: Tetrahydrofolate dehydrogenase/cyclohydrolase [53235] (2 proteins)
   automatically mapped to Pfam PF00763

6. Protein automated matches [346970] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [346971] (3 PDB entries)

8. Domain d5o2ac1: 5o2a C:2-122 [347065]
   Other proteins in same PDB: d5o2aa2, d5o2ab2, d5o2ab3, d5o2ac2, d5o2ad2
   automated match to d1b0aa2

Details for d5o2ac1

PDB Entry: 5o2a, 1.9 Å

PDB Description: fold q98h

PDB Compounds: (C:) Bifunctional protein folD

SCOPe Domain Sequences for d5o2ac1:

Sequence; same for both SEQRES and ATOM records:

>d5o2ac1 c.58.1.2 (C:2-122) automated matches {Escherichia coli [TaxId: 83333]}
aakiidgktiaqqvrsevaqkvqariaaglrapglavvlvgsnpasqiyvaskrkaceev
gfvsrsydlpettseaellelidtlnadntidgilvhlplpagidnvkvlerihpdkdvd
g

Timeline for d5o2ac1:

• d5o2ac1 is new in SCOPe 2.07-stable
  
• d5o2ac1 appears in the current release, SCOPe 2.08