SCOPe 2.07: Domain d5nxya_: 5nxy A:

Lineage for d5nxya_ (5nxy A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:535025] [189693] (7 PDB entries)

8. Domain d5nxya_: 5nxy A: [346982]
   automated match to d3r6ua_
   complexed with 1y8, edo

Details for d5nxya_

PDB Entry: 5nxy, 1.9 Å

PDB Description: crystal structure of opuac from b. subtilis in complex with arsenobetaine

PDB Compounds: (A:) Osmotically activated L-carnitine/choline ABC transporter substrate-binding protein OpuCC

SCOPe Domain Sequences for d5nxya_:

Sequence; same for both SEQRES and ATOM records:

>d5nxya_ c.94.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 535025]}
qtikigaqsmseseiiasmqgqliehhtdlktttiknlgsnavqqqalmngeidiaatry
tgdaltgtlrmepekdpdkalaltqrefkkrydlkwydsygfdntyaftvskeladqyhl
etvsdvkkwapqlklgvdnywmklkgngyqdftktygmtfggtypmqiglvydavksgkm
divlaystdgriksyglkmlkddkqffppydcspvvpekvlkehpelegiikkmlgkidt
atmqelnyevdgnlkepsvvakeylekhryfe

Timeline for d5nxya_:

• d5nxya_ is new in SCOPe 2.07-stable
  
• d5nxya_ appears in the current release, SCOPe 2.08