Lineage for d5n5fg_ (5n5f G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317304Species Haliangium ochraceum [TaxId:80816] [346709] (1 PDB entry)
  8. 2317311Domain d5n5fg_: 5n5f G: [346900]
    automated match to d1zpyg_
    complexed with na

Details for d5n5fg_

PDB Entry: 5n5f (more details), 2.06 Å

PDB Description: crystal structure of haliangium ochraceum encapsulated ferritin
PDB Compounds: (G:) encapsulated ferritin

SCOPe Domain Sequences for d5n5fg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n5fg_ a.25.1.0 (G:) automated matches {Haliangium ochraceum [TaxId: 80816]}
qlhepaellseetknmhralvtlieeleavdwyqqradacsepglhdvlihnkneeveha
mmtlewirrrspvfdahmrtylfterpilele

SCOPe Domain Coordinates for d5n5fg_:

Click to download the PDB-style file with coordinates for d5n5fg_.
(The format of our PDB-style files is described here.)

Timeline for d5n5fg_: