Class b: All beta proteins [48724] (178 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50836] (50 PDB entries) |
Domain d5n48a_: 5n48 A: [346740] Other proteins in same PDB: d5n48b_, d5n48d1, d5n48d2 automated match to d1ngla_ |
PDB Entry: 5n48 (more details), 1.6 Å
SCOPe Domain Sequences for d5n48a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n48a_ b.60.1.1 (A:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]} stsdlipapplskvplqqnfqdnqfhgkwyvvgragnmrlredkdpakmvatiyelkedk synvtkvmfqrkkckymintfvpgsqpgeftlgaiksppgptstlvrvvstnynqhamvf fkhvfqnreyfhitlygrtkeltselkenfirfskslglpenhivfpvpidqcid
Timeline for d5n48a_:
View in 3D Domains from other chains: (mouse over for more information) d5n48b_, d5n48c_, d5n48d1, d5n48d2 |