SCOPe 2.07: Domain d5bk2b1: 5bk2 B:1-366

Lineage for d5bk2b1 (5bk2 B:1-366)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Escherichia coli [TaxId:562] [53863] (69 PDB entries)
   Uniprot P02928

8. Domain d5bk2b1: 5bk2 B:1-366 [346728]
   Other proteins in same PDB: d5bk2a2, d5bk2b2, d5bk2d1, d5bk2d2, d5bk2l1, d5bk2l2
   automated match to d1jvya_
   complexed with cl, gol, mal, po4

Details for d5bk2b1

PDB Entry: 5bk2, 2.6 Å

PDB Description: crystal structure of maltose binding protein in complex with a peristeric synthetic antibody

PDB Compounds: (B:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d5bk2b1:

Sequence; same for both SEQRES and ATOM records:

>d5bk2b1 c.94.1.1 (B:1-366) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqt

Timeline for d5bk2b1:

• d5bk2b1 is new in SCOPe 2.07-stable
  
• d5bk2b1 appears in the current release, SCOPe 2.08