SCOPe 2.07: Domain d5moid2: 5moi D:439-544

Lineage for d5moid2 (5moi D:439-544)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d5moid2: 5moi D:439-544 [346713]
   automated match to d1ls0a6
   complexed with bma, edo, man, nag, peg, po4

Details for d5moid2

PDB Entry: 5moi, 2.2 Å

PDB Description: crystal structure of human ige-fc epsilon 3-4

PDB Compounds: (D:) ig epsilon chain c region

SCOPe Domain Sequences for d5moid2:

Sequence, based on SEQRES records:

>d5moid2 b.1.1.2 (D:439-544) automated matches {Human (Homo sapiens) [TaxId: 9606]}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvn

Sequence, based on observed residues (ATOM records):

>d5moid2 b.1.1.2 (D:439-544) automated matches {Human (Homo sapiens) [TaxId: 9606]}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
ffvfsrlevtraeweqkdeficravheaaspsqtvqravsvn

Timeline for d5moid2:

• d5moid2 is new in SCOPe 2.07-stable
  
• d5moid2 appears in the current release, SCOPe 2.08