SCOPe 2.07: Domain d5n2ka2: 5n2k A:113-216

Lineage for d5n2ka2 (5n2k A:113-216)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
Domain d5n2ka2: 5n2k A:113-216 [346684]
Other proteins in same PDB: d5n2ka1, d5n2kc1, d5n2ke1, d5n2kg1, d5n2ki1, d5n2kk1, d5n2km1, d5n2ko1
automated match to d1aqkl2
complexed with edo

Details for d5n2ka2

PDB Entry: 5n2k (more details), 2.22 Å

PDB Description: structure of unbound briakinumab fab

PDB Compounds: (A:) Briakinumab FAb light chain

SCOPe Domain Sequences for d5n2ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n2ka2 b.1.1.2 (A:113-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptec

SCOPe Domain Coordinates for d5n2ka2:

Click to download the PDB-style file with coordinates for d5n2ka2.
(The format of our PDB-style files is described here.)

Timeline for d5n2ka2: