SCOPe 2.07: Domain d5mu6a2: 5mu6 A:296-496

Lineage for d5mu6a2 (5mu6 A:296-496)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (48 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225745] (54 PDB entries)

8. Domain d5mu6a2: 5mu6 A:296-496 [346594]
   automated match to d3iu1a2
   complexed with gol, kfk, mg, mya

Details for d5mu6a2

PDB Entry: 5mu6, 1.88 Å

PDB Description: human n-myristoyltransferase (nmt1) with myristoyl-coa and imp-1088 inhibitor bound

PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase 1

SCOPe Domain Sequences for d5mu6a2:

Sequence; same for both SEQRES and ATOM records:

>d5mu6a2 d.108.1.0 (A:296-496) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqlltr
ylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthks
lkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlq
yylynwkcpsmgaekvglvlq

Timeline for d5mu6a2:

• d5mu6a2 is new in SCOPe 2.07-stable
  
• d5mu6a2 appears in the current release, SCOPe 2.08