Lineage for d5mola2 (5mol A:331-438)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2366211Domain d5mola2: 5mol A:331-438 [346513]
    automated match to d1ls0a5
    complexed with ae3, bma, edo, man, nag, peg, pg0

Details for d5mola2

PDB Entry: 5mol (more details), 1.75 Å

PDB Description: human ige-fc crystal structure
PDB Compounds: (A:) ig epsilon chain c region

SCOPe Domain Sequences for d5mola2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mola2 b.1.1.0 (A:331-438) automated matches {Human (Homo sapiens) [TaxId: 9606]}
snprgvsaylsrpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvnhstrkee
kqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsg

SCOPe Domain Coordinates for d5mola2:

Click to download the PDB-style file with coordinates for d5mola2.
(The format of our PDB-style files is described here.)

Timeline for d5mola2: