Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (95 species) not a true protein |
Species Streptomyces antibioticus [TaxId:1890] [279042] (8 PDB entries) |
Domain d5mnsb_: 5mns B: [346503] automated match to d3a4ha_ complexed with deb, hem |
PDB Entry: 5mns (more details), 2.62 Å
SCOPe Domain Sequences for d5mnsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mnsb_ a.104.1.0 (B:) automated matches {Streptomyces antibioticus [TaxId: 1890]} avpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsdarivlgdsrfst aaatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveemrprvrslvdsll ddmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamlsstrltaaeiqrv qqdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvslliaghetsvnq itnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrvatedvelstvtvr agepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaqlgrlelqealsa lvrrfptldlaepvaglkwkqgmlirglerqivsw
Timeline for d5mnsb_: