SCOPe 2.07: Domain d5n9ua1: 5n9u A:1-85

Lineage for d5n9ua1 (5n9u A:1-85)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [186776] (11 PDB entries)

8. Domain d5n9ua1: 5n9u A:1-85 [345809]
   Other proteins in same PDB: d5n9ua2
   automated match to d5evoa1
   complexed with gsh

Details for d5n9ua1

PDB Entry: 5n9u

PDB Description: dehydroascorbate reductase 3a from populus trichocarpa complexed with gsh.

PDB Compounds: (A:) Dehydroascorbate reductase family protein

SCOPe Domain Sequences for d5n9ua1:

Sequence; same for both SEQRES and ATOM records:

>d5n9ua1 c.47.1.0 (A:1-85) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
maleicvkaavgapnilgdcpfcqrvllsleekkipykshlinlgdkpqwfleispegkv
pvvkiddkwvadsdvivgileeknp

Timeline for d5n9ua1:

• d5n9ua1 is new in SCOPe 2.07-stable
  
• d5n9ua1 appears in the current release, SCOPe 2.08