Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [186776] (11 PDB entries) |
Domain d5n9ua1: 5n9u A:1-85 [345809] Other proteins in same PDB: d5n9ua2 automated match to d5evoa1 complexed with gsh |
PDB Entry: 5n9u (more details)
SCOPe Domain Sequences for d5n9ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n9ua1 c.47.1.0 (A:1-85) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]} maleicvkaavgapnilgdcpfcqrvllsleekkipykshlinlgdkpqwfleispegkv pvvkiddkwvadsdvivgileeknp
Timeline for d5n9ua1: