Class a: All alpha proteins [46456] (289 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) |
Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
Protein automated matches [226872] (13 species) not a true protein |
Species Brucella suis [TaxId:204722] [346172] (2 PDB entries) |
Domain d5k0tc2: 5k0t C:353-510 [345720] Other proteins in same PDB: d5k0ta1, d5k0tb1, d5k0tc1 automated match to d2x1la2 protein/RNA complex; complexed with 415, edo |
PDB Entry: 5k0t (more details), 2.6 Å
SCOPe Domain Sequences for d5k0tc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k0tc2 a.27.1.0 (C:353-510) automated matches {Brucella suis [TaxId: 204722]} andlgnlaqrslsmiakncegkvpqpgafseadkaildqadaaletarkamddqalhlal gaifavvaeanryfagqepwalrktdparmgtvlyvtaevlrrvgimvqpfipqsaekll dilavpadkrqfadvlasplaggtdlpapqpvfpryve
Timeline for d5k0tc2:
View in 3D Domains from other chains: (mouse over for more information) d5k0ta1, d5k0ta2, d5k0tb1, d5k0tb2 |