Lineage for d5gtiu_ (5gti U:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716398Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2716633Family a.60.12.2: PsbU-like [158539] (2 proteins)
    Pfam PF06514
  6. 2716634Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species)
  7. 2716639Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (20 PDB entries)
  8. 2716652Domain d5gtiu_: 5gti U: [345664]
    Other proteins in same PDB: d5gtia_, d5gtib_, d5gtic_, d5gtid_, d5gtie_, d5gtif_, d5gtih_, d5gtii_, d5gtij_, d5gtik_, d5gtil_, d5gtim1, d5gtim2, d5gtio_, d5gtit_, d5gtiv_, d5gtix_, d5gtiz_
    automated match to d2axtu1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5gtiu_

PDB Entry: 5gti (more details), 2.5 Å

PDB Description: native xfel structure of photosystem ii (two flash dataset)
PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d5gtiu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gtiu_ a.60.12.2 (U:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]}
lvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipglt
erqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d5gtiu_:

Click to download the PDB-style file with coordinates for d5gtiu_.
(The format of our PDB-style files is described here.)

Timeline for d5gtiu_: