![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) ![]() automatically mapped to Pfam PF02533 |
![]() | Family f.23.36.1: PsbK-like [161038] (2 proteins) Pfam PF02533 |
![]() | Protein Photosystem II reaction center protein K, PsbK [161039] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (26 PDB entries) |
![]() | Domain d5gtik_: 5gti K: [345658] Other proteins in same PDB: d5gtia_, d5gtib_, d5gtic_, d5gtid_, d5gtie_, d5gtif_, d5gtih_, d5gtii_, d5gtij_, d5gtil_, d5gtim1, d5gtim2, d5gtio_, d5gtit_, d5gtiu_, d5gtiv_, d5gtix_, d5gtiz_ automated match to d2axtk1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 5gti (more details), 2.5 Å
SCOPe Domain Sequences for d5gtik_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gtik_ f.23.36.1 (K:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]} klpeayaifdplvdvlpvipvlflalafvwqaavgfr
Timeline for d5gtik_: