Lineage for d5gtid_ (5gti D:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027502Protein automated matches [190224] (17 species)
    not a true protein
  7. 3027631Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (27 PDB entries)
  8. 3027662Domain d5gtid_: 5gti D: [345652]
    Other proteins in same PDB: d5gtib_, d5gtic_, d5gtie_, d5gtif_, d5gtih_, d5gtii_, d5gtij_, d5gtik_, d5gtil_, d5gtim1, d5gtim2, d5gtio_, d5gtit_, d5gtiu_, d5gtiv_, d5gtix_, d5gtiz_
    automated match to d5h2fd_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5gtid_

PDB Entry: 5gti (more details), 2.5 Å

PDB Description: native xfel structure of photosystem ii (two flash dataset)
PDB Compounds: (D:) Photosystem II D2 protein

SCOPe Domain Sequences for d5gtid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gtid_ f.26.1.1 (D:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
ergwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassyleg
cnfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqf
eiarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhn
wtlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtan
rfwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpe
fetfytknlllnegirawmapqdqphenfvfpeevlprgnal

SCOPe Domain Coordinates for d5gtid_:

Click to download the PDB-style file with coordinates for d5gtid_.
(The format of our PDB-style files is described here.)

Timeline for d5gtid_: