Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species Oryza sativa [TaxId:39947] [346305] (4 PDB entries) |
Domain d5d9va1: 5d9v A:1-86 [345576] Other proteins in same PDB: d5d9va2 automated match to d5evoa1 complexed with ca, peg |
PDB Entry: 5d9v (more details), 1.69 Å
SCOPe Domain Sequences for d5d9va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d9va1 c.47.1.0 (A:1-86) automated matches {Oryza sativa [TaxId: 39947]} mgvevcvkaavghpdtlgdcpfsqrvlltleekkvpyemklidvqnkpdwflkispegkv pvfnggdgkwipdsdvitqvieekyp
Timeline for d5d9va1: