SCOPe 2.07: Domain d5d9va1: 5d9v A:1-86

Lineage for d5d9va1 (5d9v A:1-86)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Oryza sativa [TaxId:39947] [346305] (4 PDB entries)

8. Domain d5d9va1: 5d9v A:1-86 [345576]
   Other proteins in same PDB: d5d9va2
   automated match to d5evoa1
   complexed with ca, peg

Details for d5d9va1

PDB Entry: 5d9v, 1.69 Å

PDB Description: crystal structure of oxidized dehydroascorbate reductase (osdhar) from oryza sativa l. japonica

PDB Compounds: (A:) Dehydroascorbate reductase

SCOPe Domain Sequences for d5d9va1:

Sequence; same for both SEQRES and ATOM records:

>d5d9va1 c.47.1.0 (A:1-86) automated matches {Oryza sativa [TaxId: 39947]}
mgvevcvkaavghpdtlgdcpfsqrvlltleekkvpyemklidvqnkpdwflkispegkv
pvfnggdgkwipdsdvitqvieekyp

Timeline for d5d9va1:

• d5d9va1 is new in SCOPe 2.07-stable
  
• d5d9va1 appears in the current release, SCOPe 2.08