Lineage for d5b54c_ (5b54 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2514799Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2514800Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2515225Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2515226Protein automated matches [190215] (38 species)
    not a true protein
  7. 2515282Species Fusobacterium nucleatum [TaxId:190304] [333378] (7 PDB entries)
  8. 2515295Domain d5b54c_: 5b54 C: [345549]
    Other proteins in same PDB: d5b54b2
    automated match to d5b55a_
    complexed with cl, plp

Details for d5b54c_

PDB Entry: 5b54 (more details), 2.07 Å

PDB Description: crystal structure of hydrogen sulfide-producing enzyme (fn1055) from fusobacterium nucleatum: lysine-dimethylated form
PDB Compounds: (C:) Cysteine synthase

SCOPe Domain Sequences for d5b54c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b54c_ c.79.1.0 (C:) automated matches {Fusobacterium nucleatum [TaxId: 190304]}
kkmkylenlvgktpmlelifdykgeerrifvknesynltgsikdrmafytlkkayeknei
kkgapiveatsgntgiafsamgailghpviiympdwmseerkslirsfgakiilvsrkeg
gflgsiektkefaknnpdtylpsqfsnlynseahyygigleivnemkslnlnidgfvagv
gtggtvmgigkrikenfsnakicpleplnsptlstgykvakhriegisdefipdlvkldk
ldnvvsvddgdaivmaqklakcglgvgissganfigalmlqnklgkdsvivtvfpddnkk
ylstdlmreekvkedflskditlkeiknvlrvi

SCOPe Domain Coordinates for d5b54c_:

Click to download the PDB-style file with coordinates for d5b54c_.
(The format of our PDB-style files is described here.)

Timeline for d5b54c_:

  • d5b54c_ is new in SCOPe 2.07-stable
  • d5b54c_ does not appear in SCOPe 2.08