Lineage for d4uxjf2 (4uxj F:138-181)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640848Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 2640849Protein automated matches [190463] (9 species)
    not a true protein
  7. 2640913Species Leishmania major [TaxId:5664] [346432] (3 PDB entries)
  8. 2640923Domain d4uxjf2: 4uxj F:138-181 [345474]
    Other proteins in same PDB: d4uxja1, d4uxjb1, d4uxjc1, d4uxjd1, d4uxje1, d4uxjf1, d4uxjg1, d4uxjh1
    automated match to d5fuwa2
    complexed with mg, ttp, zn

Details for d4uxjf2

PDB Entry: 4uxj (more details), 3 Å

PDB Description: leishmania major thymidine kinase in complex with dttp
PDB Compounds: (F:) Thymidine kinase

SCOPe Domain Sequences for d4uxjf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uxjf2 g.39.1.0 (F:138-181) automated matches {Leishmania major [TaxId: 5664]}
avcmmcheqpacftrrtvnveqqeliggadmyiatcrecyskqq

SCOPe Domain Coordinates for d4uxjf2:

Click to download the PDB-style file with coordinates for d4uxjf2.
(The format of our PDB-style files is described here.)

Timeline for d4uxjf2: