Class g: Small proteins [56992] (98 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.0: automated matches [191378] (1 protein) not a true family |
Protein automated matches [190463] (9 species) not a true protein |
Species Leishmania major [TaxId:5664] [346432] (3 PDB entries) |
Domain d4uxjf2: 4uxj F:138-181 [345474] Other proteins in same PDB: d4uxja1, d4uxjb1, d4uxjc1, d4uxjd1, d4uxje1, d4uxjf1, d4uxjg1, d4uxjh1 automated match to d5fuwa2 complexed with mg, ttp, zn |
PDB Entry: 4uxj (more details), 3 Å
SCOPe Domain Sequences for d4uxjf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uxjf2 g.39.1.0 (F:138-181) automated matches {Leishmania major [TaxId: 5664]} avcmmcheqpacftrrtvnveqqeliggadmyiatcrecyskqq
Timeline for d4uxjf2: