SCOPe 2.07: Domain d4kh7b2: 4kh7 B:80-208

Lineage for d4kh7b2 (4kh7 B:80-208)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (71 species)
   not a true protein

7. Species Salmonella enterica [TaxId:90370] [346178] (1 PDB entry)

8. Domain d4kh7b2: 4kh7 B:80-208 [345321]
   Other proteins in same PDB: d4kh7a1, d4kh7a3, d4kh7b1, d4kh7b3
   automated match to d5f06a2
   complexed with gsh

Details for d4kh7b2

PDB Entry: 4kh7, 1.5 Å

PDB Description: Crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione

PDB Compounds: (B:) Glutathione S-transferase family protein

SCOPe Domain Sequences for d4kh7b2:

Sequence; same for both SEQRES and ATOM records:

>d4kh7b2 a.45.1.0 (B:80-208) automated matches {Salmonella enterica [TaxId: 90370]}
gqnrlwvdnparraegekwmdwanqtlspahrvilmglvrtppekrdqaaieagiekcds
lfallddalahqpwfsgdnfgtgdiaiapfvynllnvglkwtprpnlqrwyqqlterpaf
rkvvmipvt

Timeline for d4kh7b2:

• d4kh7b2 is new in SCOPe 2.07-stable
  
• d4kh7b2 appears in the current release, SCOPe 2.08