Lineage for d4fiqf_ (4fiq F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2435328Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2436130Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2436131Protein automated matches [190292] (37 species)
    not a true protein
  7. 2436319Species Pyrococcus horikoshii [TaxId:70601] [346271] (2 PDB entries)
  8. 2436325Domain d4fiqf_: 4fiq F: [345268]
    automated match to d2yzra_

Details for d4fiqf_

PDB Entry: 4fiq (more details), 2.7 Å

PDB Description: crystal structure of pyridoxal biosynthesis lyase pdxs from pyrococcus horikoshii
PDB Compounds: (F:) Pyridoxal biosynthesis lyase pdxS

SCOPe Domain Sequences for d4fiqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fiqf_ c.1.2.0 (F:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
dklkiimekgterlkrgfakmvkggvimdvtnaeqariaeeagavavmalhkvpadirka
ggvarmapvekiqeimdavtipvmakcrigheaearilealgvdmidesevltpadpffh
iykkkftapfvcgarnlgeavrriwegaamirtkgeagtgniieavrhvrlvnenirliq
rmtdeeiygvaekfaepylrlafsvkeisglpkrvlenepiyegftyreivediykille
ikklgrlpvvnfaaggvatpadaalmmamgmdgvfvgsgifkssnppkmaraiveavnhw
depdvlaeisreigepmrgqa

SCOPe Domain Coordinates for d4fiqf_:

Click to download the PDB-style file with coordinates for d4fiqf_.
(The format of our PDB-style files is described here.)

Timeline for d4fiqf_: