Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (95 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [196470] (50 PDB entries) |
Domain d4fdhk_: 4fdh K: [345259] Other proteins in same PDB: d4fdhe2, d4fdhf2 automated match to d3na1b_ complexed with 0t3, hem |
PDB Entry: 4fdh (more details), 2.71 Å
SCOPe Domain Sequences for d4fdhk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fdhk_ a.104.1.0 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggprmvcvml pedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnpdvlspka vqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfgerlglvg hspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqygdnciqk iyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmtlfelarn pdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervvssdlvlq nyhipagtlvqvflyslgrnaalfprperynpqrwldirgsgrnfhhvpfgfgmrqclgr rlaeaemllllhhvlkhflvetltqedikmvysfilrpgtsplltfrai
Timeline for d4fdhk_: