Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.67: PLP-dependent transferases [53382] (1 superfamily) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) |
Family c.67.1.5: Ornithine decarboxylase major domain [53444] (1 protein) |
Protein Ornithine decarboxylase major domain [53445] (1 species) |
Species Lactobacillus sp., strain 30a [TaxId:1591] [53446] (2 PDB entries) |
Domain d1ordb2: 1ord B:108-569 [34504] Other proteins in same PDB: d1orda1, d1orda3, d1ordb1, d1ordb3 complexed with plp |
PDB Entry: 1ord (more details), 3 Å
SCOP Domain Sequences for d1ordb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ordb2 c.67.1.5 (B:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a} ppffkslkeyvsrgliqfdcpghqggqyyrkhpagrefydffgetvfradlcnadvalgd llihegpavaaekhaarvynadktyfvlggssnanntvtsalvsngdlvlfdrnnhksvy nsalamaggrpvylqtnrnpygfiggiydsdfdekkirelaakvdperakwkrpfrlavi qlgtydgtiynahevvkrighlcdyiefdsawvgyeqfipmmrnssplliddlgpedpgi ivvqsvhkqqagfsqtsqihkkdshikgqlrycdhkhfnnsfnlfmstspfypmyaaldv naamqegeagrklwhdllittiearkklikagsmfrpfvppvvngkkwedgdtedmanni dywrfekgakwhayegygdnqyyvdpnkfmlttpginpetgdyedfgvpativanylrdh giipeksdlnsilflmtpaetpakmnnlitqllqlqrlieed
Timeline for d1ordb2: