SCOP 1.71: Domain d1orda1: 1ord A:1-107

Lineage for d1orda1 (1ord A:1-107)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (5 families)

5. Family c.23.1.4: Ornithine decarboxylase N-terminal "wing" domain [52252] (1 protein)

6. Protein Ornithine decarboxylase N-terminal "wing" domain [52253] (1 species)

7. Species Lactobacillus sp., strain 30a [TaxId:1591] [52254] (2 PDB entries)

8. Domain d1orda1: 1ord A:1-107 [31274]
   Other proteins in same PDB: d1orda2, d1orda3, d1ordb2, d1ordb3

Details for d1orda1

PDB Entry: 1ord, 3 Å

PDB Description: crystallographic structure of a plp-dependent ornithine decarboxylase from lactobacillus 30a to 3.1 angstroms resolution

SCOP Domain Sequences for d1orda1:

Sequence; same for both SEQRES and ATOM records:

>d1orda1 c.23.1.4 (A:1-107) Ornithine decarboxylase N-terminal "wing" domain {Lactobacillus sp., strain 30a}
ssslkiastqearqyfdtdrvvvdavgsdftdvgaviamdyetdvidaadatkfgipvfa
vtkdaqaisadelkkifhiidlenkfdatvnareietavnnyedsil

Timeline for d1orda1:

• d1orda1 first appeared (with stable ids) in SCOP 1.55
  
• d1orda1 appears in SCOP 1.69
  
• d1orda1 appears in SCOP 1.73
  
• d1orda1 appears in the current release, SCOPe 2.08