Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) Pfam PF06596 |
Family f.23.40.1: PsbX-like [267615] (2 proteins) |
Protein automated matches [267680] (2 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [311275] (12 PDB entries) |
Domain d5mx2x_: 5mx2 X: [344372] Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2c_, d5mx2d_, d5mx2e_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2j_, d5mx2k_, d5mx2l_, d5mx2m_, d5mx2o_, d5mx2t_, d5mx2u_, d5mx2v_, d5mx2z_ automated match to d5v2cx_ complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd |
PDB Entry: 5mx2 (more details), 2.2 Å
SCOPe Domain Sequences for d5mx2x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mx2x_ f.23.40.1 (X:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} titpslkgffigllsgavvlgltfavliaisqidkvq
Timeline for d5mx2x_: