Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) |
Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
Protein Cytochrome b559 subunit alpha, PsbE [161047] (2 species) |
Species Thermosynechococcus elongatus [TaxId:146786] [161048] (7 PDB entries) Uniprot Q8DIP0 3-84 |
Domain d5mx2e_: 5mx2 E: [344369] Other proteins in same PDB: d5mx2a_, d5mx2b_, d5mx2c_, d5mx2d_, d5mx2f_, d5mx2h_, d5mx2i_, d5mx2j_, d5mx2k_, d5mx2l_, d5mx2m_, d5mx2o_, d5mx2t_, d5mx2u_, d5mx2v_, d5mx2x_, d5mx2z_ automated match to d2axte1 complexed with bcr, bct, cl, cla, dgd, fe, hem, lfa, lhg, lmg, pho, pl9, sqd has additional insertions and/or extensions that are not grouped together |
PDB Entry: 5mx2 (more details), 2.2 Å
SCOPe Domain Sequences for d5mx2e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mx2e_ f.23.38.1 (E:) Cytochrome b559 subunit alpha, PsbE {Thermosynechococcus elongatus [TaxId: 146786]} gttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrs iplvtdrfeakqqvetfleql
Timeline for d5mx2e_: