Lineage for d5ln1a_ (5ln1 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468413Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2468414Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2468415Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2468566Protein automated matches [190060] (2 species)
    not a true protein
  7. 2468567Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346319] (1 PDB entry)
  8. 2468568Domain d5ln1a_: 5ln1 A: [344344]
    Other proteins in same PDB: d5ln1u_
    automated match to d4cr2w_

Details for d5ln1a_

PDB Entry: 5ln1 (more details), 3.14 Å

PDB Description: structure of ubiquitylated-rpn10 from yeast;
PDB Compounds: (A:) 26s proteasome regulatory subunit rpn10

SCOPe Domain Sequences for d5ln1a_:

Sequence, based on SEQRES records: (download)

>d5ln1a_ c.62.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mvleatvlvidnseysrngdfprtrfeaqidsvefifqakrnsnpentvglisgaganpr
vlstftaefgkilaglhdtqiegklhmatalqiaqltlkhrqnkvqhqrivafvcspisd
srdelirlaktlkknnvavdiinfgeieqntelldefiaavnnpqeetshlltvtpgprl
lyeniasspii

Sequence, based on observed residues (ATOM records): (download)

>d5ln1a_ c.62.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mvleatvlvidnseysrngdfprtrfeaqidsvefifqakrnsnpentvglisgaganpr
vlstftaefgkilaglhdtqiegklhmatalqiaqltlkhrqnkvqhqrivafvcspisd
srdelirlaktlkknnvavdiinfgeieqlldefiaavnnpqeetshlltvtpgprllye
niasspii

SCOPe Domain Coordinates for d5ln1a_:

Click to download the PDB-style file with coordinates for d5ln1a_.
(The format of our PDB-style files is described here.)

Timeline for d5ln1a_:

  • d5ln1a_ is new in SCOPe 2.07-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d5ln1u_