Lineage for d1qgne_ (1qgn E:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 705666Family c.67.1.3: Cystathionine synthase-like [53402] (16 proteins)
  6. 705730Protein Cystathionine gamma-synthase, CGS [53405] (2 species)
  7. 705731Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [53407] (4 PDB entries)
  8. 705736Domain d1qgne_: 1qgn E: [34407]

Details for d1qgne_

PDB Entry: 1qgn (more details), 2.9 Å

PDB Description: cystathionine gamma-synthase from nicotiana tabacum
PDB Compounds: (E:) protein (cystathionine gamma-synthase)

SCOP Domain Sequences for d1qgne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgne_ c.67.1.3 (E:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]}
mkyasflnsdgsvaihagerlgrgivtdaittpvvntsayffnktselidfkekrrasfe
ygrygnpttvvleekisalegaestllmasgmcastvmllalvpagghivtttdcyrktr
ifietilpkmgitatvidpadvgalelalnqkkvnlfftesptnpflrcvdielvsklch
ekgalvcidgtfatplnqkalalgadlvlhsatkflgghndvlagcisgplklvseirnl
hhilggalnpnaayliirgmktlhlrvqqqnstalrmaeileahpkvrhvyypglqshpe
hhiakkqmtgfggavsfevdgdllttakfvdalkipyiapsfggcesivdqpaimsywdl
sqsdrakygimdnlvrfsfgvedfddlkadilqaldsi

SCOP Domain Coordinates for d1qgne_:

Click to download the PDB-style file with coordinates for d1qgne_.
(The format of our PDB-style files is described here.)

Timeline for d1qgne_: