Lineage for d5xhga1 (5xhg A:1-106)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355339Species Escherichia coli [TaxId:316407] [343294] (1 PDB entry)
  8. 2355340Domain d5xhga1: 5xhg A:1-106 [343329]
    Other proteins in same PDB: d5xhga2, d5xhgb1, d5xhgb2, d5xhgc2, d5xhgd1, d5xhgd2
    automated match to d1dn0a1
    complexed with edo, oaz, peg, so4

Details for d5xhga1

PDB Entry: 5xhg (more details), 1.76 Å

PDB Description: crystal structure of trastuzumab fab fragment bearing ne-(o- azidobenzyloxycarbonyl)-l-lysine
PDB Compounds: (A:) polypeptide(L)

SCOPe Domain Sequences for d5xhga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xhga1 b.1.1.0 (A:1-106) automated matches {Escherichia coli [TaxId: 316407]}
diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasflysgvps
rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkvei

SCOPe Domain Coordinates for d5xhga1:

Click to download the PDB-style file with coordinates for d5xhga1.
(The format of our PDB-style files is described here.)

Timeline for d5xhga1: