SCOPe 2.07: Domain d5mi3a1: 5mi3 A:9-205

Lineage for d5mi3a1 (5mi3 A:9-205)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (34 species)
   not a true protein

7. Species Escherichia coli [TaxId:331112] [343069] (2 PDB entries)

8. Domain d5mi3a1: 5mi3 A:9-205 [343117]
   Other proteins in same PDB: d5mi3a2, d5mi3a3, d5mi3b2, d5mi3b3
   automated match to d1d8ta3
   complexed with gdp, mg

Details for d5mi3a1

PDB Entry: 5mi3, 2.8 Å

PDB Description: structure of phosphorylated translation elongation factor ef-tu from e. coli

PDB Compounds: (A:) Elongation factor Tu 1

SCOPe Domain Sequences for d5mi3a1:

Sequence; same for both SEQRES and ATOM records:

>d5mi3a1 c.37.1.8 (A:9-205) automated matches {Escherichia coli [TaxId: 331112]}
tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
ilelagfldsyipeper

Timeline for d5mi3a1:

• d5mi3a1 first appeared in SCOPe 2.06
  
• d5mi3a1 appears in the current release, SCOPe 2.08