Lineage for d5mknl_ (5mkn L:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2397050Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2397051Protein automated matches [190914] (14 species)
    not a true protein
  7. 2397262Species Methanococcus vannielii [TaxId:2187] [343057] (1 PDB entry)
  8. 2397274Domain d5mknl_: 5mkn L: [343098]
    automated match to d1mgqa_
    complexed with pg4, u5p

Details for d5mknl_

PDB Entry: 5mkn (more details), 2.55 Å

PDB Description: crystal structure of smap (lsm) protein from methanococcus vannielii
PDB Compounds: (L:) Like-Sm ribonucleoprotein core

SCOPe Domain Sequences for d5mknl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mknl_ b.38.1.0 (L:) automated matches {Methanococcus vannielii [TaxId: 2187]}
mdtqrpldalgksintnvtvylkdgklvkgrlkaydlhmnvalenakiesdeekefpmlv
vrgdnvlyvsl

SCOPe Domain Coordinates for d5mknl_:

Click to download the PDB-style file with coordinates for d5mknl_.
(The format of our PDB-style files is described here.)

Timeline for d5mknl_: