Lineage for d5m00g1 (5m00 G:9-119)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (619 PDB entries)
  8. 2358062Domain d5m00g1: 5m00 G:9-119 [343045]
    Other proteins in same PDB: d5m00a1, d5m00a2, d5m00b1, d5m00b2, d5m00g2, d5m00h2
    automated match to d1tcra1

Details for d5m00g1

PDB Entry: 5m00 (more details), 1.95 Å

PDB Description: crystal structure of murine p14 tcr complex with h-2db and y4a, modified gp33 peptide from lcmv
PDB Compounds: (G:) Protein Trav14-1,Uncharacterized protein

SCOPe Domain Sequences for d5m00g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m00g1 b.1.1.0 (G:9-119) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qqvrqspqsltvweggttvltcsyedstfnyfpwyqqfpgegpallisilsvsdkkedgr
fttffnkrekklslhiidsqpgdsatyfcaalygnekitfgagtkltikpn

SCOPe Domain Coordinates for d5m00g1:

Click to download the PDB-style file with coordinates for d5m00g1.
(The format of our PDB-style files is described here.)

Timeline for d5m00g1: