Lineage for d1amqa_ (1amq A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2502822Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2502882Protein Aspartate aminotransferase, AAT [53385] (9 species)
  7. 2502917Species Escherichia coli [TaxId:562] [53390] (84 PDB entries)
    Uniprot P00509
  8. 2503010Domain d1amqa_: 1amq A: [34300]
    complexed with pmp

Details for d1amqa_

PDB Entry: 1amq (more details), 2.2 Å

PDB Description: x-ray crystallographic study of pyridoxamine 5'-phosphate-type aspartate aminotransferases from escherichia coli in three forms
PDB Compounds: (A:) aspartate aminotransferase

SCOPe Domain Sequences for d1amqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1amqa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]}
mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
assysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
lreefgvyavasgrvnvagmtpdnmaplceaivavl

SCOPe Domain Coordinates for d1amqa_:

Click to download the PDB-style file with coordinates for d1amqa_.
(The format of our PDB-style files is described here.)

Timeline for d1amqa_: