Lineage for d5xmma1 (5xmm A:2-182)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163006Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2163926Protein automated matches [191280] (4 species)
    not a true protein
  7. 2299601Species Felis catus [TaxId:9685] [342902] (2 PDB entries)
  8. 2299616Domain d5xmma1: 5xmm A:2-182 [342917]
    Other proteins in same PDB: d5xmma2, d5xmmb_
    automated match to d3kpma1

Details for d5xmma1

PDB Entry: 5xmm (more details), 2.9 Å

PDB Description: fla-e*01801-167w/s
PDB Compounds: (A:) MHC class I antigen alpha chain

SCOPe Domain Sequences for d5xmma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xmma1 d.19.1.1 (A:2-182) automated matches {Felis catus [TaxId: 9685]}
gshslryfytavsrpglgeprfiavgyvddtqfvrfdsdapnprmeprapwveqegpeyw
dretrkvkntaqifrvdlntllryynqsesgshniqrmygcdvepdgrllrgynqdsydg
kdyialnedlrswtaadtaaqitgrkweeageaerwrnylqgtcveslakyldmgketll
r

SCOPe Domain Coordinates for d5xmma1:

Click to download the PDB-style file with coordinates for d5xmma1.
(The format of our PDB-style files is described here.)

Timeline for d5xmma1:

  • d5xmma1 appears in periodic updates to SCOPe 2.06 starting on 2017-12-14

View in 3D
Domains from same chain:
(mouse over for more information)
d5xmma2
View in 3D
Domains from other chains:
(mouse over for more information)
d5xmmb_