Lineage for d5xmfa2 (5xmf A:183-276)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (16 species)
    not a true protein
  7. 2299603Species Felis catus [TaxId:9685] [342904] (2 PDB entries)
  8. 2299604Domain d5xmfa2: 5xmf A:183-276 [342905]
    Other proteins in same PDB: d5xmfa1, d5xmfb_
    automated match to d1efxa1

Details for d5xmfa2

PDB Entry: 5xmf (more details), 2.1 Å

PDB Description: crystal structure of feline mhc class i for 2,1 angstrom
PDB Compounds: (A:) MHC class I antigen alpha chain

SCOPe Domain Sequences for d5xmfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xmfa2 b.1.1.2 (A:183-276) automated matches {Felis catus [TaxId: 9685]}
aespntrvtrhpisdrevtlrcwalgfypaeitltwqrdgqdhtqdaelvetrpagdgtf
qkwaavvvssgeeqrytchvqheglrepitlrwe

SCOPe Domain Coordinates for d5xmfa2:

Click to download the PDB-style file with coordinates for d5xmfa2.
(The format of our PDB-style files is described here.)

Timeline for d5xmfa2:

  • d5xmfa2 appears in periodic updates to SCOPe 2.06 starting on 2017-12-14

View in 3D
Domains from same chain:
(mouse over for more information)
d5xmfa1
View in 3D
Domains from other chains:
(mouse over for more information)
d5xmfb_