Lineage for d5n0ka4 (5n0k A:548-699)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382309Species Norway rat (Rattus norvegicus) [TaxId:10116] [342789] (1 PDB entry)
  8. 2382313Domain d5n0ka4: 5n0k A:548-699 [342793]
    automated match to d1kcwa4
    complexed with ca, cu, na, nag

Details for d5n0ka4

PDB Entry: 5n0k (more details), 2.3 Å

PDB Description: rat ceruloplasmin orthorhombic form
PDB Compounds: (A:) ceruloplasmin

SCOPe Domain Sequences for d5n0ka4:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n0ka4 b.6.1.0 (A:548-699) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dvdkefylfatvfdeneslllddnirmfttapenvdkededfqesnkmhsmngfmygnlp
glnmclgesivwylfsagneadvhgiyfsgntylskgerrdtanlfphksltllmtpdte
gsfdveclttdhytggmkqkytvnqckgqfed

SCOPe Domain Coordinates for d5n0ka4:

Click to download the PDB-style file with coordinates for d5n0ka4.
(The format of our PDB-style files is described here.)

Timeline for d5n0ka4: