Class b: All beta proteins [48724] (178 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins) automatically mapped to Pfam PF00194 |
Protein Carbonic anhydrase [51071] (10 species) |
Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (971 PDB entries) Uniprot P00918 |
Domain d6equa1: 6equ A:1-261 [342776] Other proteins in same PDB: d6equa2 automated match to d2foua_ complexed with bve, zn |
PDB Entry: 6equ (more details), 1.65 Å
SCOPe Domain Sequences for d6equa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6equa1 b.74.1.1 (A:1-261) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]} mshhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslril nnghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhl vhwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdp rgllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelm vdnwrpaqplknrqikasfk
Timeline for d6equa1: