Lineage for d6ex7b1 (6ex7 B:31-270)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603630Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries)
  8. 2603786Domain d6ex7b1: 6ex7 B:31-270 [342707]
    Other proteins in same PDB: d6ex7b2
    automated match to d4eyba_
    complexed with cd, cl, edo, pg4, toe, unl

Details for d6ex7b1

PDB Entry: 6ex7 (more details), 1.95 Å

PDB Description: crystal structure of ndm-1 metallo-beta-lactamase in complex with cd ions and a hydrolyzed beta-lactam ligand - new refinement
PDB Compounds: (B:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d6ex7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ex7b1 d.157.1.0 (B:31-270) automated matches {Klebsiella pneumoniae [TaxId: 573]}
irptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvd
tawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlap
qegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcli
kdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d6ex7b1:

Click to download the PDB-style file with coordinates for d6ex7b1.
(The format of our PDB-style files is described here.)

Timeline for d6ex7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ex7b2
View in 3D
Domains from other chains:
(mouse over for more information)
d6ex7a_