SCOPe 2.07: Domain d5uipa1: 5uip A:2-159

Lineage for d5uipa1 (5uip A:2-159)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (27 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [267778] (6 PDB entries)

8. Domain d5uipa1: 5uip A:2-159 [341901]
   Other proteins in same PDB: d5uipa2, d5uipb2
   automated match to d2w9ta_
   complexed with 8dm, lg3, na, nap

Details for d5uipa1

PDB Entry: 5uip, 1.9 Å

PDB Description: structure of dhfr with bound dap, p-abg and nadp

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d5uipa1:

Sequence; same for both SEQRES and ATOM records:

>d5uipa1 c.71.1.0 (A:2-159) automated matches {Escherichia coli [TaxId: 562]}
isliaalavdrvigmenampwnlpadlawfkrntlnkpvimgrhtwesigrplpgrknii
lssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeveg
dthfpdyepddwesvfsefhdadaqnshsysfeilerr

Timeline for d5uipa1:

• d5uipa1 first appeared in SCOPe 2.06
  
• d5uipa1 appears in the current release, SCOPe 2.08