Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
Protein automated matches [190777] (27 species) not a true protein |
Species Escherichia coli [TaxId:562] [267778] (6 PDB entries) |
Domain d5uiod_: 5uio D: [341895] automated match to d3tq9a_ complexed with 8dm, bme, fmt, lg3, nap |
PDB Entry: 5uio (more details), 1.93 Å
SCOPe Domain Sequences for d5uiod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uiod_ c.71.1.0 (D:) automated matches {Escherichia coli [TaxId: 562]} mmisliaalavdrvigmenampwnlpadlawfkrntlnkpvimgrhtwesigrplpgrkn iilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaev egdthfpdyepddwesvfsefhdadaqnshsycfeilerr
Timeline for d5uiod_:
View in 3D Domains from other chains: (mouse over for more information) d5uioa_, d5uiob_, d5uioc_, d5uioe_ |