Lineage for d6bk7b2 (6bk7 B:281-404)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2054165Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2054227Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2054536Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2054537Protein automated matches [226946] (25 species)
    not a true protein
  7. 2298495Species Enterococcus faecalis [TaxId:226185] [341796] (1 PDB entry)
  8. 2298498Domain d6bk7b2: 6bk7 B:281-404 [341799]
    Other proteins in same PDB: d6bk7a1, d6bk7b1
    automated match to d2bv3a1
    complexed with na

Details for d6bk7b2

PDB Entry: 6bk7 (more details), 1.83 Å

PDB Description: 1.83 angstrom resolution crystal structure of n-terminal fragment (residues 1-404) of elongation factor g from enterococcus faecalis
PDB Compounds: (B:) Elongation factor G

SCOPe Domain Sequences for d6bk7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bk7b2 b.43.3.0 (B:281-404) automated matches {Enterococcus faecalis [TaxId: 226185]}
pldidaikgidtktdeettrpaddeapfaslafkvmtdpfvgrltffrvysgvlesgsyv
lnaskgkkerigrilqmhantrqeidkvysgdiaaavglkdtttgdtlcaldapvilesi
efpd

SCOPe Domain Coordinates for d6bk7b2:

Click to download the PDB-style file with coordinates for d6bk7b2.
(The format of our PDB-style files is described here.)

Timeline for d6bk7b2:

  • d6bk7b2 appears in periodic updates to SCOPe 2.06 starting on 2017-11-24

View in 3D
Domains from same chain:
(mouse over for more information)
d6bk7b1